SCOPe 2.05: Domain d1luna_: 1lun A:

Lineage for d1luna_ (1lun A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Itk/tsk protein tyrosine kinase [82743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries)

8. Domain d1luna_: 1lun A: [78229]

Details for d1luna_

PDB Entry: 1lun

PDB Description: nmr structure of the itk sh2 domain, pro287trans, energy minimized average structure

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d1luna_:

Sequence; same for both SEQRES and ATOM records:

>d1luna_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg

Timeline for d1luna_:

• d1luna_ first appeared in SCOP 1.63
  
• d1luna_ appears in SCOPe 2.04
  
• d1luna_ is called d1luna1 in SCOPe 2.06
  
• d1luna_ appears in the current release, SCOPe 2.08, called d1luna1