Lineage for d1luna1 (1lun A:4-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965513Protein Itk/tsk protein tyrosine kinase [82743] (1 species)
  7. 2965514Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries)
  8. 2965518Domain d1luna1: 1lun A:4-110 [78229]
    Other proteins in same PDB: d1luna2

Details for d1luna1

PDB Entry: 1lun (more details)

PDB Description: nmr structure of the itk sh2 domain, pro287trans, energy minimized average structure
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d1luna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luna1 d.93.1.1 (A:4-110) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc

SCOPe Domain Coordinates for d1luna1:

Click to download the PDB-style file with coordinates for d1luna1.
(The format of our PDB-style files is described here.)

Timeline for d1luna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1luna2