| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Itk/tsk protein tyrosine kinase [82743] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries) |
| Domain d1luna1: 1lun A:4-110 [78229] Other proteins in same PDB: d1luna2 |
PDB Entry: 1lun (more details)
SCOPe Domain Sequences for d1luna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luna1 d.93.1.1 (A:4-110) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc
Timeline for d1luna1: