Lineage for d1lujb_ (1luj B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779562Fold a.161: beta-catenin-interacting protein ICAT [81729] (1 superfamily)
    core: 3 helices; irregular array
  4. 779563Superfamily a.161.1: beta-catenin-interacting protein ICAT [81730] (1 family) (S)
  5. 779564Family a.161.1.1: beta-catenin-interacting protein ICAT [81731] (1 protein)
  6. 779565Protein beta-catenin-interacting protein ICAT [81732] (1 species)
    consists of a globular N-domain and extended C-terminal tail
  7. 779566Species Human (Homo sapiens) [TaxId:9606] [81733] (3 PDB entries)
    Uniprot Q9NSA3 8-53
  8. 779569Domain d1lujb_: 1luj B: [78226]
    Other proteins in same PDB: d1luja_

Details for d1lujb_

PDB Entry: 1luj (more details), 2.5 Å

PDB Description: crystal structure of the beta-catenin/icat complex
PDB Compounds: (B:) beta-catenin-interacting protein ICAT

SCOP Domain Sequences for d1lujb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lujb_ a.161.1.1 (B:) beta-catenin-interacting protein ICAT {Human (Homo sapiens) [TaxId: 9606]}
gapakspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvssqlsqlpqhsidqaa
edvvmafsrse

SCOP Domain Coordinates for d1lujb_:

Click to download the PDB-style file with coordinates for d1lujb_.
(The format of our PDB-style files is described here.)

Timeline for d1lujb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1luja_