Class a: All alpha proteins [46456] (284 folds) |
Fold a.161: beta-catenin-interacting protein ICAT [81729] (1 superfamily) core: 3 helices; irregular array |
Superfamily a.161.1: beta-catenin-interacting protein ICAT [81730] (1 family) |
Family a.161.1.1: beta-catenin-interacting protein ICAT [81731] (1 protein) |
Protein beta-catenin-interacting protein ICAT [81732] (1 species) consists of a globular N-domain and extended C-terminal tail |
Species Human (Homo sapiens) [TaxId:9606] [81733] (3 PDB entries) Uniprot Q9NSA3 8-53 |
Domain d1lujb_: 1luj B: [78226] Other proteins in same PDB: d1luja_ |
PDB Entry: 1luj (more details), 2.5 Å
SCOP Domain Sequences for d1lujb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lujb_ a.161.1.1 (B:) beta-catenin-interacting protein ICAT {Human (Homo sapiens) [TaxId: 9606]} gapakspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvssqlsqlpqhsidqaa edvvmafsrse
Timeline for d1lujb_: