Lineage for d1luia_ (1lui A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260293Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 260294Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 260295Family d.93.1.1: SH2 domain [55551] (22 proteins)
  6. 260401Protein Itk/tsk protein tyrosine kinase [82743] (1 species)
  7. 260402Species Mouse (Mus musculus) [TaxId:10090] [82744] (4 PDB entries)
  8. 260403Domain d1luia_: 1lui A: [78224]
    complexed with ace, nh2

Details for d1luia_

PDB Entry: 1lui (more details)

PDB Description: nmr structures of itk sh2 domain, pro287cis isoform, ensemble of 20 low energy structures

SCOP Domain Sequences for d1luia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus)}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg

SCOP Domain Coordinates for d1luia_:

Click to download the PDB-style file with coordinates for d1luia_.
(The format of our PDB-style files is described here.)

Timeline for d1luia_: