Lineage for d1lufa_ (1luf A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735344Protein Musk tyrosine kinase [82797] (1 species)
    PTK group; MUSK subfamily; non-membrane spanning protein tyrosine kinase
  7. 735345Species Rat (Rattus norvegicus) [TaxId:10116] [82798] (1 PDB entry)
  8. 735346Domain d1lufa_: 1luf A: [78223]

Details for d1lufa_

PDB Entry: 1luf (more details), 2.05 Å

PDB Description: crystal structure of the musk tyrosine kinase: insights into receptor autoregulation
PDB Compounds: (A:) muscle-specific tyrosine kinase receptor musk

SCOP Domain Sequences for d1lufa_:

Sequence, based on SEQRES records: (download)

>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]}
lnpkllsleyprnnieyvrdigegafgrvfqarapgllpyepftmvavkmlkeeasadmq
adfqreaalmaefdnpnivkllgvcavgkpmcllfeymaygdlneflrsmsphtvcslsh
sdlstrarvsspgppplscaeqlciarqvaagmaylserkfvhrdlatrnclvgenmvvk
iadfglsrniysadyykadgndaipirwmppesifynryttesdvwaygvvlweifsygl
qpyygmaheeviyyvrdgnilacpencplelynlmrlcwsklpadrpsfcsihrilqrmc
e

Sequence, based on observed residues (ATOM records): (download)

>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]}
lnpkllsleyprnnieyvrdigegafgrvfqarapgllpyepftmvavkmlkeeasadmq
adfqreaalmaefdnpnivkllgvcavgkpmcllfeymaygdlneflrsmsppplscaeq
lciarqvaagmaylserkfvhrdlatrnclvgenmvvkiadfglsrniysadyykdaipi
rwmppesifynryttesdvwaygvvlweifsyglqpyygmaheeviyyvrdgnilacpen
cplelynlmrlcwsklpadrpsfcsihrilqrmce

SCOP Domain Coordinates for d1lufa_:

Click to download the PDB-style file with coordinates for d1lufa_.
(The format of our PDB-style files is described here.)

Timeline for d1lufa_: