Lineage for d1luda_ (1lud A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249080Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 249081Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 249082Family c.71.1.1: Dihydrofolate reductases [53598] (3 protein domains)
  6. 249086Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 249151Species Lactobacillus casei [TaxId:1582] [53601] (6 PDB entries)
  8. 249157Domain d1luda_: 1lud A: [78222]
    complexed with ndp, trr

Details for d1luda_

PDB Entry: 1lud (more details)

PDB Description: solution structure of dihydrofolate reductase complexed with trimethoprim and nadph, 24 structures

SCOP Domain Sequences for d1luda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luda_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

SCOP Domain Coordinates for d1luda_:

Click to download the PDB-style file with coordinates for d1luda_.
(The format of our PDB-style files is described here.)

Timeline for d1luda_: