| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
| Protein Methylene-tetrahydromethanopterin dehydrogenase [82303] (1 species) |
| Species Methylobacterium extorquens [TaxId:408] [82304] (2 PDB entries) |
| Domain d1luac1: 1lua C:98-288 [78220] Other proteins in same PDB: d1luaa2, d1luab2, d1luac2 complexed with nap |
PDB Entry: 1lua (more details), 1.9 Å
SCOPe Domain Sequences for d1luac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luac1 c.2.1.7 (C:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}
gsnttaaagvalvvkaaggsvkgkkavvlagtgpvgmrsaallagegaevvlcgrkldka
qaaadsvnkrfkvnvtaaetaddasraeavkgahfvftagaiglellpqaawqnessiei
vadynaqpplgiggidatdkgkeyggkrafgalgigglklklhraciaklfessegvfda
eeiyklakema
Timeline for d1luac1:
View in 3DDomains from other chains: (mouse over for more information) d1luaa1, d1luaa2, d1luab1, d1luab2 |