SCOPe 2.07: Domain d1luab2: 1lua B:2-97

Lineage for d1luab2 (1lua B:2-97)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.4: Methylene-tetrahydromethanopterin dehydrogenase [82333] (1 protein)
   automatically mapped to Pfam PF09176

6. Protein Methylene-tetrahydromethanopterin dehydrogenase [82334] (1 species)

7. Species Methylobacterium extorquens [TaxId:408] [82335] (2 PDB entries)

8. Domain d1luab2: 1lua B:2-97 [78219]
   Other proteins in same PDB: d1luaa1, d1luab1, d1luac1
   complexed with nap

Details for d1luab2

PDB Entry: 1lua, 1.9 Å

PDB Description: Structure of methylene-tetrahydromethanopterin dehydrogenase from Methylobacterium extorquens AM1 complexed with NADP

PDB Compounds: (B:) Methylene Tetrahydromethanopterin Dehydrogenase

SCOPe Domain Sequences for d1luab2:

Sequence; same for both SEQRES and ATOM records:

>d1luab2 c.58.1.4 (B:2-97) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}
skkllfqfdtdatpsvfdvvvgydggadhitgygnvtpdnvgayvdgtiytrggkekqst
aifvgggdmaagervfeavkkrffgpfrvscmldsn

Timeline for d1luab2:

• d1luab2 first appeared in SCOP 1.63
  
• d1luab2 appears in SCOPe 2.06
  
• d1luab2 appears in the current release, SCOPe 2.08