Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) |
Family c.58.1.4: Methylene-tetrahydromethanopterin dehydrogenase [82333] (1 protein) |
Protein Methylene-tetrahydromethanopterin dehydrogenase [82334] (1 species) |
Species Methylobacterium extorquens [TaxId:408] [82335] (2 PDB entries) |
Domain d1luab2: 1lua B:2-97 [78219] Other proteins in same PDB: d1luaa1, d1luab1, d1luac1 |
PDB Entry: 1lua (more details), 1.9 Å
SCOP Domain Sequences for d1luab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luab2 c.58.1.4 (B:2-97) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens} skkllfqfdtdatpsvfdvvvgydggadhitgygnvtpdnvgayvdgtiytrggkekqst aifvgggdmaagervfeavkkrffgpfrvscmldsn
Timeline for d1luab2:
View in 3D Domains from other chains: (mouse over for more information) d1luaa1, d1luaa2, d1luac1, d1luac2 |