Lineage for d1luab2 (1lua B:2-97)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 246933Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 246934Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 247078Family c.58.1.4: Methylene-tetrahydromethanopterin dehydrogenase [82333] (1 protein)
  6. 247079Protein Methylene-tetrahydromethanopterin dehydrogenase [82334] (1 species)
  7. 247080Species Methylobacterium extorquens [TaxId:408] [82335] (2 PDB entries)
  8. 247085Domain d1luab2: 1lua B:2-97 [78219]
    Other proteins in same PDB: d1luaa1, d1luab1, d1luac1

Details for d1luab2

PDB Entry: 1lua (more details), 1.9 Å

PDB Description: Structure of methylene-tetrahydromethanopterin dehydrogenase from Methylobacterium extorquens AM1 complexed with NADP

SCOP Domain Sequences for d1luab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luab2 c.58.1.4 (B:2-97) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens}
skkllfqfdtdatpsvfdvvvgydggadhitgygnvtpdnvgayvdgtiytrggkekqst
aifvgggdmaagervfeavkkrffgpfrvscmldsn

SCOP Domain Coordinates for d1luab2:

Click to download the PDB-style file with coordinates for d1luab2.
(The format of our PDB-style files is described here.)

Timeline for d1luab2: