![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.4: Methylene-tetrahydromethanopterin dehydrogenase [82333] (1 protein) automatically mapped to Pfam PF09176 |
![]() | Protein Methylene-tetrahydromethanopterin dehydrogenase [82334] (1 species) |
![]() | Species Methylobacterium extorquens [TaxId:408] [82335] (2 PDB entries) |
![]() | Domain d1luab2: 1lua B:2-97 [78219] Other proteins in same PDB: d1luaa1, d1luab1, d1luac1 complexed with nap |
PDB Entry: 1lua (more details), 1.9 Å
SCOPe Domain Sequences for d1luab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luab2 c.58.1.4 (B:2-97) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} skkllfqfdtdatpsvfdvvvgydggadhitgygnvtpdnvgayvdgtiytrggkekqst aifvgggdmaagervfeavkkrffgpfrvscmldsn
Timeline for d1luab2:
![]() Domains from other chains: (mouse over for more information) d1luaa1, d1luaa2, d1luac1, d1luac2 |