Lineage for d1luaa2 (1lua A:2-97)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498398Family c.58.1.4: Methylene-tetrahydromethanopterin dehydrogenase [82333] (1 protein)
    automatically mapped to Pfam PF09176
  6. 2498399Protein Methylene-tetrahydromethanopterin dehydrogenase [82334] (1 species)
  7. 2498400Species Methylobacterium extorquens [TaxId:408] [82335] (2 PDB entries)
  8. 2498401Domain d1luaa2: 1lua A:2-97 [78217]
    Other proteins in same PDB: d1luaa1, d1luab1, d1luac1
    complexed with nap

Details for d1luaa2

PDB Entry: 1lua (more details), 1.9 Å

PDB Description: Structure of methylene-tetrahydromethanopterin dehydrogenase from Methylobacterium extorquens AM1 complexed with NADP
PDB Compounds: (A:) Methylene Tetrahydromethanopterin Dehydrogenase

SCOPe Domain Sequences for d1luaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luaa2 c.58.1.4 (A:2-97) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}
skkllfqfdtdatpsvfdvvvgydggadhitgygnvtpdnvgayvdgtiytrggkekqst
aifvgggdmaagervfeavkkrffgpfrvscmldsn

SCOPe Domain Coordinates for d1luaa2:

Click to download the PDB-style file with coordinates for d1luaa2.
(The format of our PDB-style files is described here.)

Timeline for d1luaa2: