Lineage for d1lu9c2 (1lu9 C:2-97)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587802Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 587803Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 588016Family c.58.1.4: Methylene-tetrahydromethanopterin dehydrogenase [82333] (1 protein)
  6. 588017Protein Methylene-tetrahydromethanopterin dehydrogenase [82334] (1 species)
  7. 588018Species Methylobacterium extorquens [TaxId:408] [82335] (2 PDB entries)
  8. 588021Domain d1lu9c2: 1lu9 C:2-97 [78215]
    Other proteins in same PDB: d1lu9a1, d1lu9b1, d1lu9c1

Details for d1lu9c2

PDB Entry: 1lu9 (more details), 1.9 Å

PDB Description: Structure of methylene-tetrahydromethanopterin dehydrogenase from Methylobacterium extorquens AM1

SCOP Domain Sequences for d1lu9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lu9c2 c.58.1.4 (C:2-97) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens}
skkllfqfdtdatpsvfdvvvgydggadhitgygnvtpdnvgayvdgtiytrggkekqst
aifvgggdmaagervfeavkkrffgpfrvscmldsn

SCOP Domain Coordinates for d1lu9c2:

Click to download the PDB-style file with coordinates for d1lu9c2.
(The format of our PDB-style files is described here.)

Timeline for d1lu9c2: