![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Methylene-tetrahydromethanopterin dehydrogenase [82303] (1 species) |
![]() | Species Methylobacterium extorquens [TaxId:408] [82304] (2 PDB entries) |
![]() | Domain d1lu9b1: 1lu9 B:98-288 [78212] Other proteins in same PDB: d1lu9a2, d1lu9b2, d1lu9c2 |
PDB Entry: 1lu9 (more details), 1.9 Å
SCOPe Domain Sequences for d1lu9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lu9b1 c.2.1.7 (B:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} gsnttaaagvalvvkaaggsvkgkkavvlagtgpvgmrsaallagegaevvlcgrkldka qaaadsvnkrfkvnvtaaetaddasraeavkgahfvftagaiglellpqaawqnessiei vadynaqpplgiggidatdkgkeyggkrafgalgigglklklhraciaklfessegvfda eeiyklakema
Timeline for d1lu9b1:
![]() Domains from other chains: (mouse over for more information) d1lu9a1, d1lu9a2, d1lu9c1, d1lu9c2 |