Lineage for d1lu9b1 (1lu9 B:98-288)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845315Protein Methylene-tetrahydromethanopterin dehydrogenase [82303] (1 species)
  7. 2845316Species Methylobacterium extorquens [TaxId:408] [82304] (2 PDB entries)
  8. 2845321Domain d1lu9b1: 1lu9 B:98-288 [78212]
    Other proteins in same PDB: d1lu9a2, d1lu9b2, d1lu9c2
    has additional insertions and/or extensions that are not grouped together

Details for d1lu9b1

PDB Entry: 1lu9 (more details), 1.9 Å

PDB Description: Structure of methylene-tetrahydromethanopterin dehydrogenase from Methylobacterium extorquens AM1
PDB Compounds: (B:) Methylene Tetrahydromethanopterin Dehydrogenase

SCOPe Domain Sequences for d1lu9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lu9b1 c.2.1.7 (B:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}
gsnttaaagvalvvkaaggsvkgkkavvlagtgpvgmrsaallagegaevvlcgrkldka
qaaadsvnkrfkvnvtaaetaddasraeavkgahfvftagaiglellpqaawqnessiei
vadynaqpplgiggidatdkgkeyggkrafgalgigglklklhraciaklfessegvfda
eeiyklakema

SCOPe Domain Coordinates for d1lu9b1:

Click to download the PDB-style file with coordinates for d1lu9b1.
(The format of our PDB-style files is described here.)

Timeline for d1lu9b1: