SCOP 1.67: Domain d1ltqa1: 1ltq A:153-301

Lineage for d1ltqa1 (1ltq A:153-301)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (14 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.9: Polynucleotide kinase, phosphatase domain [82385] (1 protein)
   no insertion subdomains

6. Protein Polynucleotide kinase, phosphatase domain [82386] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [82387] (4 PDB entries)

8. Domain d1ltqa1: 1ltq A:153-301 [78208]
   Other proteins in same PDB: d1ltqa2
   complexed with adp, dms, mse

Details for d1ltqa1

PDB Entry: 1ltq, 2.33 Å

PDB Description: crystal structure of t4 polynucleotide kinase

SCOP Domain Sequences for d1ltqa1:

Sequence; same for both SEQRES and ATOM records:

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4}
ngtpgkpkavifdvdgtlakmngrgpydlekcdtdvinpmvvelskmyalmgyqivvvsg
resgtkedptkyyrmtrkwvediagvplvmqcqreqgdtrkddvvkeeifwkhiaphfdv
klaiddrtqvvemwrrigvecwqvasgdf

Timeline for d1ltqa1:

• d1ltqa1 first appeared in SCOP 1.63
  
• d1ltqa1 appears in SCOP 1.65
  
• d1ltqa1 appears in SCOP 1.69
  
• d1ltqa1 appears in the current release, SCOPe 2.08