Lineage for d1ltqa1 (1ltq A:153-301)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322675Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 322676Superfamily c.108.1: HAD-like [56784] (10 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 322770Family c.108.1.9: Polynucleotide kinase, phosphatase domain [82385] (1 protein)
    no insertion subdomains
  6. 322771Protein Polynucleotide kinase, phosphatase domain [82386] (1 species)
  7. 322772Species Bacteriophage T4 [TaxId:10665] [82387] (1 PDB entry)
  8. 322773Domain d1ltqa1: 1ltq A:153-301 [78208]
    Other proteins in same PDB: d1ltqa2
    complexed with adp, dms, mse

Details for d1ltqa1

PDB Entry: 1ltq (more details), 2.33 Å

PDB Description: crystal structure of t4 polynucleotide kinase

SCOP Domain Sequences for d1ltqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4}
ngtpgkpkavifdvdgtlakmngrgpydlekcdtdvinpmvvelskmyalmgyqivvvsg
resgtkedptkyyrmtrkwvediagvplvmqcqreqgdtrkddvvkeeifwkhiaphfdv
klaiddrtqvvemwrrigvecwqvasgdf

SCOP Domain Coordinates for d1ltqa1:

Click to download the PDB-style file with coordinates for d1ltqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ltqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ltqa2