![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (33 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen beta chain [88892] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries) |
![]() | Domain d1lt9e2: 1lt9 E:165-199 [78195] Other proteins in same PDB: d1lt9a_, d1lt9b1, d1lt9c1, d1lt9c2, d1lt9d_, d1lt9e1, d1lt9f1, d1lt9f2 coiled-coil region only complexed with ca, nag |
PDB Entry: 1lt9 (more details), 2.8 Å
SCOP Domain Sequences for d1lt9e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lt9e2 h.1.8.1 (E:165-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]} lrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1lt9e2: