Lineage for d1lt7b_ (1lt7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090074Superfamily c.1.26: Homocysteine S-methyltransferase [82282] (1 family) (S)
  5. 2090075Family c.1.26.1: Homocysteine S-methyltransferase [82283] (3 protein domains)
    Pfam PF02574
  6. 2090076Protein Betaine-homocysteine S-methyltransferase [82284] (2 species)
  7. 2090077Species Human (Homo sapiens) [TaxId:9606] [82285] (2 PDB entries)
  8. 2090081Domain d1lt7b_: 1lt7 B: [78185]
    complexed with cit, sm

Details for d1lt7b_

PDB Entry: 1lt7 (more details), 2.15 Å

PDB Description: Oxidized Homo sapiens betaine-homocysteine S-methyltransferase in complex with four Sm(III) ions
PDB Compounds: (B:) betaine-homocysteine methyltransferase

SCOPe Domain Sequences for d1lt7b_:

Sequence, based on SEQRES records: (download)

>d1lt7b_ c.1.26.1 (B:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
kgilerlnageivigdggfvfalekrgyvkagpwtpeaavehpeavrqlhreflragsnv
mqtftfyasedklenrgnyvlekisgqevneaaadiarqvadegdalvaggvsqtpsyls
aksetevkkvflqqlevfmkknvdfliaeyfehveeavwavetliasgkpvaatmaigpe
gdlhgvppgeaavrlvkagasiigvnchfdptislktvklmkegleaaqlkahlmsqpla
yhtpdankqgfidlpefpfgleprvatrwdiqkyareaynlgvryiggccgfepyhirai
aeelapergflppasekhgswgsgldmhtkpwvrararkeywenlriasgrpynpsmskp
d

Sequence, based on observed residues (ATOM records): (download)

>d1lt7b_ c.1.26.1 (B:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
kgilerlnageivigdggfvfalekrgyhpeavrqlhreflragsnvmqtftvneaaadi
arqvadegdalvaggvsqtpsylsaksetevkkvflqqlevfmkknvdfliaeyfehvee
avwavetliasgkpvaatmaigpegdlhgvppgeaavrlvkagasiigvnchfdptislk
tvklmkegleaaqlkahlmsqplayhtpdankqgfidlpefpfgleprvatrwdiqkyar
eaynlgvryiggccgfepyhiraiaeelapergflppgldmhtkpwvrararkeywenlr
iasgrpynpsmskpd

SCOPe Domain Coordinates for d1lt7b_:

Click to download the PDB-style file with coordinates for d1lt7b_.
(The format of our PDB-style files is described here.)

Timeline for d1lt7b_: