Lineage for d1lsva_ (1lsv A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609514Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 609552Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)
  6. 609563Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 609564Species Bradyrhizobium japonicum [TaxId:375] [55792] (9 PDB entries)
  8. 609569Domain d1lsva_: 1lsv A: [78180]
    complexed with cmo, hem

Details for d1lsva_

PDB Entry: 1lsv (more details), 2.4 Å

PDB Description: Crystal structure of the CO-bound BjFixL heme domain

SCOP Domain Sequences for d1lsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsva_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum}
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq

SCOP Domain Coordinates for d1lsva_:

Click to download the PDB-style file with coordinates for d1lsva_.
(The format of our PDB-style files is described here.)

Timeline for d1lsva_: