Class g: Small proteins [56992] (98 folds) |
Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily) disulfide-rich fold; all-beta: 3 antiparallel strands |
Superfamily g.60.1: TSP-1 type 1 repeat [82895] (2 families) automatically mapped to Pfam PF00090 |
Family g.60.1.1: TSP-1 type 1 repeat [82896] (2 proteins) |
Protein Thrombospondin-1 (TSP-1) [82897] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82898] (1 PDB entry) |
Domain d1lsla2: 1lsl A:470-528 [78179] repeats 2 and 3 (res. 434-546) complexed with fuc, ful |
PDB Entry: 1lsl (more details), 1.9 Å
SCOPe Domain Sequences for d1lsla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lsla2 g.60.1.1 (A:470-528) Thrombospondin-1 (TSP-1) {Human (Homo sapiens) [TaxId: 9606]} acpinggwgpwspwdicsvtcgggvqkrsrlcnnptpqfggkdcvgdvtenqicnkqdc
Timeline for d1lsla2: