SCOPe 2.06: Domain d1lsla2: 1lsl A:470-528

Lineage for d1lsla2 (1lsl A:470-528)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily)
   disulfide-rich fold; all-beta: 3 antiparallel strands

4. Superfamily g.60.1: TSP-1 type 1 repeat [82895] (2 families)
   automatically mapped to Pfam PF00090

5. Family g.60.1.1: TSP-1 type 1 repeat [82896] (2 proteins)

6. Protein Thrombospondin-1 (TSP-1) [82897] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82898] (1 PDB entry)

8. Domain d1lsla2: 1lsl A:470-528 [78179]
   repeats 2 and 3 (res. 434-546)
   complexed with fuc, ful

Details for d1lsla2

PDB Entry: 1lsl, 1.9 Å

PDB Description: crystal structure of the thrombospondin-1 type 1 repeats

PDB Compounds: (A:) Thrombospondin 1

SCOPe Domain Sequences for d1lsla2:

Sequence; same for both SEQRES and ATOM records:

>d1lsla2 g.60.1.1 (A:470-528) Thrombospondin-1 (TSP-1) {Human (Homo sapiens) [TaxId: 9606]}
acpinggwgpwspwdicsvtcgggvqkrsrlcnnptpqfggkdcvgdvtenqicnkqdc

Timeline for d1lsla2:

• d1lsla2 first appeared in SCOP 1.63
  
• d1lsla2 appears in SCOPe 2.05
  
• d1lsla2 appears in SCOPe 2.07
  
• d1lsla2 appears in the current release, SCOPe 2.08