![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily) disulfide-rich fold; all-beta: 3 antiparallel strands |
![]() | Superfamily g.60.1: TSP-1 type 1 repeat [82895] (2 families) ![]() automatically mapped to Pfam PF00090 |
![]() | Family g.60.1.1: TSP-1 type 1 repeat [82896] (2 proteins) |
![]() | Protein Thrombospondin-1 (TSP-1) [82897] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82898] (1 PDB entry) |
![]() | Domain d1lsla1: 1lsl A:416-469 [78178] repeats 2 and 3 (res. 434-546) complexed with fuc, ful |
PDB Entry: 1lsl (more details), 1.9 Å
SCOPe Domain Sequences for d1lsla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lsla1 g.60.1.1 (A:416-469) Thrombospondin-1 (TSP-1) {Human (Homo sapiens) [TaxId: 9606]} qdggwshwspwsscsvtcgdgvitrirlcnspspqmngkpcegearetkackkd
Timeline for d1lsla1: