SCOP 1.63: Domain d1ls9a_: 1ls9 A:

Lineage for d1ls9a_ (1ls9 A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)

7. Species Green alga Cladophora glomerata [81674] (1 PDB entry)

8. Domain d1ls9a_: 1ls9 A: [78177]
   complexed with hem

Details for d1ls9a_

PDB Entry: 1ls9, 1.3 Å

PDB Description: Structure of the Cytochrome c6 from the Green Alga Cladophora glomerata

SCOP Domain Sequences for d1ls9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ls9a_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Green alga Cladophora glomerata}
vdaelladgkkvfagncaachlggnnsvladktlkkdaiekyleggltleaikyqvnngk
gampawadrldeddieavsnyvydqavnskw

Timeline for d1ls9a_:

• d1ls9a_ is new in SCOP 1.63
  
• d1ls9a_ appears in SCOP 1.65
  
• d1ls9a_ appears in the current release, SCOPe 2.07