SCOPe 2.03: Domain d1ls8a_: 1ls8 A:

Lineage for d1ls8a_ (1ls8 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Moth pheromone-binding protein, PBP [47569] (2 species)

7. Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (4 PDB entries)

8. Domain d1ls8a_: 1ls8 A: [78176]

Details for d1ls8a_

PDB Entry: 1ls8

PDB Description: nmr structure of the unliganded bombyx mori pheromone-binding protein at physiological ph

PDB Compounds: (A:) pheromone binding protein

SCOPe Domain Sequences for d1ls8a_:

Sequence; same for both SEQRES and ATOM records:

>d1ls8a_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev

Timeline for d1ls8a_:

• d1ls8a_ first appeared in SCOP 1.63
  
• d1ls8a_ appears in SCOPe 2.02
  
• d1ls8a_ appears in SCOPe 2.04
  
• d1ls8a_ appears in the current release, SCOPe 2.08