Class a: All alpha proteins [46456] (202 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins) |
Protein Moth pheromone-binding protein, PBP [47569] (2 species) |
Species Silk moth (Bombyx mori) [TaxId:7091] [47570] (3 PDB entries) |
Domain d1ls8a_: 1ls8 A: [78176] |
PDB Entry: 1ls8 (more details)
SCOP Domain Sequences for d1ls8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ls8a_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Silk moth (Bombyx mori)} sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka eihklnwapsmdvavgeilaev
Timeline for d1ls8a_: