Lineage for d1ls1a2 (1ls1 A:89-295)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111930Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 2111941Species Thermus aquaticus [TaxId:271] [52665] (17 PDB entries)
  8. 2111942Domain d1ls1a2: 1ls1 A:89-295 [78171]
    Other proteins in same PDB: d1ls1a1
    complexed with mg, oxy

Details for d1ls1a2

PDB Entry: 1ls1 (more details), 1.1 Å

PDB Description: T. aquaticus Ffh NG Domain at 1.1A Resolution
PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d1ls1a2:

Sequence, based on SEQRES records: (download)

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

Sequence, based on observed residues (ATOM records): (download)

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagglepfyperlagrilgmg

SCOPe Domain Coordinates for d1ls1a2:

Click to download the PDB-style file with coordinates for d1ls1a2.
(The format of our PDB-style files is described here.)

Timeline for d1ls1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ls1a1