Lineage for d1ls1a1 (1ls1 A:1-88)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535751Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 535752Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 535765Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 535776Species Thermus aquaticus [TaxId:271] [47367] (11 PDB entries)
  8. 535777Domain d1ls1a1: 1ls1 A:1-88 [78170]
    Other proteins in same PDB: d1ls1a2
    complexed with mo5, oxy

Details for d1ls1a1

PDB Entry: 1ls1 (more details), 1.1 Å

PDB Description: T. aquaticus Ffh NG Domain at 1.1A Resolution

SCOP Domain Sequences for d1ls1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d1ls1a1:

Click to download the PDB-style file with coordinates for d1ls1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ls1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ls1a2