SCOP 1.65: Domain d1ls1a1: 1ls1 A:1-88

Lineage for d1ls1a1 (1ls1 A:1-88)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (2 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (8 PDB entries)

8. Domain d1ls1a1: 1ls1 A:1-88 [78170]
   Other proteins in same PDB: d1ls1a2
   complexed with mo5, oxy

Details for d1ls1a1

PDB Entry: 1ls1, 1.1 Å

PDB Description: T. aquaticus Ffh NG Domain at 1.1A Resolution

SCOP Domain Sequences for d1ls1a1:

Sequence; same for both SEQRES and ATOM records:

>d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d1ls1a1:

• d1ls1a1 first appeared in SCOP 1.63
  
• d1ls1a1 appears in SCOP 1.67
  
• d1ls1a1 appears in the current release, SCOPe 2.08