Lineage for d1lrza1 (1lrz A:245-309)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 276870Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 276935Superfamily a.2.7: tRNA-binding arm [46589] (4 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 276960Family a.2.7.4: Methicillin resistance protein FemA probable tRNA-binding arm [81671] (1 protein)
    inserted in the C-terminal NAT-like domain
  6. 276961Protein Methicillin resistance protein FemA probable tRNA-binding arm [81672] (1 species)
    proposed to bind tRNA-Gly
  7. 276962Species Staphylococcus aureus [TaxId:1280] [81673] (1 PDB entry)
  8. 276963Domain d1lrza1: 1lrz A:245-309 [78167]
    Other proteins in same PDB: d1lrza2, d1lrza3

Details for d1lrza1

PDB Entry: 1lrz (more details), 2.1 Å

PDB Description: x-ray crystal structure of staphylococcus aureus femA

SCOP Domain Sequences for d1lrza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrza1 a.2.7.4 (A:245-309) Methicillin resistance protein FemA probable tRNA-binding arm {Staphylococcus aureus}
fdeyikelneerdilnkdlnkalkdiekrpenkkahnkrdnlqqqldaneqkieegkrlq
eehgn

SCOP Domain Coordinates for d1lrza1:

Click to download the PDB-style file with coordinates for d1lrza1.
(The format of our PDB-style files is described here.)

Timeline for d1lrza1: