![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) ![]() |
![]() | Family d.32.1.2: Antibiotic resistance proteins [54598] (3 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
![]() | Protein Fosfomycin resistance protein A (FosA) [82630] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [82631] (3 PDB entries) |
![]() | Domain d1lqpb_: 1lqp B: [78152] complexed with fcn, k, mn |
PDB Entry: 1lqp (more details), 1.19 Å
SCOP Domain Sequences for d1lqpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqpb_ d.32.1.2 (B:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa} mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl aacrqapyagmrfa
Timeline for d1lqpb_: