Lineage for d1lqpb_ (1lqp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942433Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2942460Protein Fosfomycin resistance protein A (FosA) [82630] (2 species)
  7. 2942461Species Pseudomonas aeruginosa [TaxId:287] [82631] (5 PDB entries)
  8. 2942465Domain d1lqpb_: 1lqp B: [78152]
    complexed with fcn, k, mn

Details for d1lqpb_

PDB Entry: 1lqp (more details), 1.19 Å

PDB Description: crystal structure of the fosfomycin resistance protein (fosa) containing bound substrate
PDB Compounds: (B:) probable fosfomycin resistance protein

SCOPe Domain Sequences for d1lqpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqpb_ d.32.1.2 (B:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

SCOPe Domain Coordinates for d1lqpb_:

Click to download the PDB-style file with coordinates for d1lqpb_.
(The format of our PDB-style files is described here.)

Timeline for d1lqpb_: