Lineage for d1lqoa_ (1lqo A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327552Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 327553Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 327582Family d.32.1.2: Antibiotic resistance proteins [54598] (3 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 327605Protein Fosfomycin resistance protein A (FosA) [82630] (1 species)
  7. 327606Species Pseudomonas aeruginosa [TaxId:287] [82631] (3 PDB entries)
  8. 327611Domain d1lqoa_: 1lqo A: [78149]

Details for d1lqoa_

PDB Entry: 1lqo (more details), 2 Å

PDB Description: Crystal Strutcure of the Fosfomycin Resistance Protein A (FosA) Containing Bound Thallium Cations

SCOP Domain Sequences for d1lqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqoa_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

SCOP Domain Coordinates for d1lqoa_:

Click to download the PDB-style file with coordinates for d1lqoa_.
(The format of our PDB-style files is described here.)

Timeline for d1lqoa_: