| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families) ![]() |
| Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
| Protein Uracil-DNA glycosylase [52143] (5 species) |
| Species Escherichia coli [TaxId:562] [52146] (12 PDB entries) |
| Domain d1lqmg_: 1lqm G: [78147] Other proteins in same PDB: d1lqmb_, d1lqmd_, d1lqmf_, d1lqmh_ protein/DNA complex |
PDB Entry: 1lqm (more details), 3.2 Å
SCOPe Domain Sequences for d1lqmg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqmg_ c.18.1.1 (G:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
Timeline for d1lqmg_: