Lineage for d1lqmg_ (1lqm G:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825199Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 825200Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families) (S)
  5. 825201Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 825202Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 825209Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 825227Domain d1lqmg_: 1lqm G: [78147]
    Other proteins in same PDB: d1lqmb_, d1lqmd_, d1lqmf_, d1lqmh_

Details for d1lqmg_

PDB Entry: 1lqm (more details), 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (G:) uracil-DNA glycosylase

SCOP Domain Sequences for d1lqmg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqmg_ c.18.1.1 (G:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

SCOP Domain Coordinates for d1lqmg_:

Click to download the PDB-style file with coordinates for d1lqmg_.
(The format of our PDB-style files is described here.)

Timeline for d1lqmg_: