Lineage for d1lqme_ (1lqm E:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578428Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 578429Superfamily c.18.1: DNA glycosylase [52141] (3 families) (S)
  5. 578430Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 578431Protein Uracil-DNA glycosylase [52143] (4 species)
  7. 578435Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 578450Domain d1lqme_: 1lqm E: [78145]
    Other proteins in same PDB: d1lqmb_, d1lqmd_, d1lqmf_, d1lqmh_

Details for d1lqme_

PDB Entry: 1lqm (more details), 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1lqme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqme_ c.18.1.1 (E:) Uracil-DNA glycosylase {Escherichia coli}
eltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgq
dpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvllln
tvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvl
kaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpae

SCOP Domain Coordinates for d1lqme_:

Click to download the PDB-style file with coordinates for d1lqme_.
(The format of our PDB-style files is described here.)

Timeline for d1lqme_: