SCOP 1.65: Domain d1lqme_: 1lqm E:

Lineage for d1lqme_ (1lqm E:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1lqme_: 1lqm E: [78145]
   Other proteins in same PDB: d1lqmb_, d1lqmd_, d1lqmf_, d1lqmh_

Details for d1lqme_

PDB Entry: 1lqm, 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1lqme_:

Sequence; same for both SEQRES and ATOM records:

>d1lqme_ c.18.1.1 (E:) Uracil-DNA glycosylase {Escherichia coli}
eltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgq
dpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvllln
tvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvl
kaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpae

Timeline for d1lqme_:

• d1lqme_ first appeared in SCOP 1.63
  
• d1lqme_ appears in SCOP 1.67
  
• d1lqme_ appears in the current release, SCOPe 2.08