| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) ![]() has an additional strand at the C-terminus and a helix inserted after the first strand |
| Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
| Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
| Species Bacteriophage pbs2 [TaxId:10684] [54445] (10 PDB entries) |
| Domain d1lqmd_: 1lqm D: [78144] Other proteins in same PDB: d1lqma_, d1lqmc_, d1lqme_, d1lqmg_ protein/DNA complex |
PDB Entry: 1lqm (more details), 3.2 Å
SCOPe Domain Sequences for d1lqmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqmd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml
Timeline for d1lqmd_: