SCOPe 2.06: Domain d1lqma_: 1lqm A:

Lineage for d1lqma_ (1lqm A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1lqma_: 1lqm A: [78141]
   Other proteins in same PDB: d1lqmb_, d1lqmd_, d1lqmf_, d1lqmh_
   protein/DNA complex

Details for d1lqma_

PDB Entry: 1lqm, 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1lqma_:

Sequence; same for both SEQRES and ATOM records:

>d1lqma_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
eltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgq
dpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvllln
tvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvl
kaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

Timeline for d1lqma_:

• d1lqma_ first appeared in SCOP 1.63
  
• d1lqma_ appears in SCOPe 2.05
  
• d1lqma_ appears in SCOPe 2.07
  
• d1lqma_ appears in the current release, SCOPe 2.08