SCOP 1.65: Domain d1lqka_: 1lqk A:

Lineage for d1lqka_ (1lqk A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (3 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Fosfomycin resistance protein A (FosA) [82630] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82631] (3 PDB entries)

8. Domain d1lqka_: 1lqk A: [78139]

Details for d1lqka_

PDB Entry: 1lqk, 1.35 Å

PDB Description: high resolution structure of fosfomycin resistance protein a (fosa)

SCOP Domain Sequences for d1lqka_:

Sequence; same for both SEQRES and ATOM records:

>d1lqka_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

Timeline for d1lqka_:

• d1lqka_ first appeared in SCOP 1.63
  
• d1lqka_ appears in SCOP 1.67
  
• d1lqka_ appears in the current release, SCOPe 2.08