SCOP 1.75: Domain d1lqjd_: 1lqj D:

Lineage for d1lqjd_ (1lqj D:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1lqjd_: 1lqj D: [78138]

Details for d1lqjd_

PDB Entry: 1lqj, 3.35 Å

PDB Description: escherichia coli uracil-dna glycosylase

PDB Compounds: (D:) uracil-DNA glycosylase

SCOP Domain Sequences for d1lqjd_:

Sequence; same for both SEQRES and ATOM records:

>d1lqjd_ c.18.1.1 (D:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg
qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll
ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv
lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes

Timeline for d1lqjd_:

• d1lqjd_ first appeared in SCOP 1.63
  
• d1lqjd_ appears in SCOP 1.73
  
• d1lqjd_ appears in SCOPe 2.01
  
• d1lqjd_ appears in the current release, SCOPe 2.08