Lineage for d1lqjb_ (1lqj B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837328Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1837329Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1837330Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 1837331Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 1837346Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 1837366Domain d1lqjb_: 1lqj B: [78136]

Details for d1lqjb_

PDB Entry: 1lqj (more details), 3.35 Å

PDB Description: escherichia coli uracil-dna glycosylase
PDB Compounds: (B:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1lqjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqjb_ c.18.1.1 (B:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

SCOPe Domain Coordinates for d1lqjb_:

Click to download the PDB-style file with coordinates for d1lqjb_.
(The format of our PDB-style files is described here.)

Timeline for d1lqjb_: