SCOP 1.73: Domain d1lqjb_: 1lqj B:

Lineage for d1lqjb_ (1lqj B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (4 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1lqjb_: 1lqj B: [78136]

Details for d1lqjb_

PDB Entry: 1lqj, 3.35 Å

PDB Description: escherichia coli uracil-dna glycosylase

PDB Compounds: (B:) uracil-DNA glycosylase

SCOP Domain Sequences for d1lqjb_:

Sequence; same for both SEQRES and ATOM records:

>d1lqjb_ c.18.1.1 (B:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

Timeline for d1lqjb_:

• d1lqjb_ first appeared in SCOP 1.63
  
• d1lqjb_ appears in SCOP 1.71
  
• d1lqjb_ appears in SCOP 1.75
  
• d1lqjb_ appears in the current release, SCOPe 2.08, called d1lqjb1