Lineage for d1lqja1 (1lqj A:2-228)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463295Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2463296Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2463297Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2463298Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2463313Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 2463332Domain d1lqja1: 1lqj A:2-228 [78135]
    Other proteins in same PDB: d1lqja2, d1lqjb2, d1lqjc2

Details for d1lqja1

PDB Entry: 1lqj (more details), 3.35 Å

PDB Description: escherichia coli uracil-dna glycosylase
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1lqja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqja1 c.18.1.1 (A:2-228) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes

SCOPe Domain Coordinates for d1lqja1:

Click to download the PDB-style file with coordinates for d1lqja1.
(The format of our PDB-style files is described here.)

Timeline for d1lqja1: