SCOP 1.63: Domain d1lqja_: 1lqj A:

Lineage for d1lqja_ (1lqj A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1lqja_: 1lqj A: [78135]

Details for d1lqja_

PDB Entry: 1lqj, 3.35 Å

PDB Description: escherichia coli uracil-dna glycosylase

SCOP Domain Sequences for d1lqja_:

Sequence; same for both SEQRES and ATOM records:

>d1lqja_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
maneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvi
lgqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvl
llntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrh
hvlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes

Timeline for d1lqja_:

• d1lqja_ is new in SCOP 1.63
  
• d1lqja_ appears in SCOP 1.65
  
• d1lqja_ appears in the current release, SCOPe 2.08, called d1lqja1