Lineage for d1lqgd_ (1lqg D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2544457Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 2544458Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 2544459Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species)
  7. 2544464Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries)
  8. 2544491Domain d1lqgd_: 1lqg D: [78134]
    Other proteins in same PDB: d1lqga_, d1lqgb_
    protein/DNA complex

Details for d1lqgd_

PDB Entry: 1lqg (more details), 2.9 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (D:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d1lqgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqgd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
sngenkikml

SCOPe Domain Coordinates for d1lqgd_:

Click to download the PDB-style file with coordinates for d1lqgd_.
(The format of our PDB-style files is described here.)

Timeline for d1lqgd_: