Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) has an additional strand at the C-terminus and a helix inserted after the first strand |
Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
Species Bacteriophage pbs2 [TaxId:10684] [54445] (9 PDB entries) |
Domain d1lqgd_: 1lqg D: [78134] Other proteins in same PDB: d1lqga_, d1lqgb_ |
PDB Entry: 1lqg (more details), 2.9 Å
SCOP Domain Sequences for d1lqgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqgd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd sngenkikml
Timeline for d1lqgd_: