Lineage for d1lqgc_ (1lqg C:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 856156Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 856157Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 856158Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 856161Species Bacteriophage pbs2 [TaxId:10684] [54445] (10 PDB entries)
  8. 856179Domain d1lqgc_: 1lqg C: [78133]
    Other proteins in same PDB: d1lqga_, d1lqgb_

Details for d1lqgc_

PDB Entry: 1lqg (more details), 2.9 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (C:) uracil-DNA glycosylase inhibitor

SCOP Domain Sequences for d1lqgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqgc_ d.17.5.1 (C:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalv
iqdsngenkikml

SCOP Domain Coordinates for d1lqgc_:

Click to download the PDB-style file with coordinates for d1lqgc_.
(The format of our PDB-style files is described here.)

Timeline for d1lqgc_: