Lineage for d1lqgb_ (1lqg B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101206Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2101207Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2101208Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 protein domains)
  6. 2101209Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2101224Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 2101236Domain d1lqgb_: 1lqg B: [78132]
    Other proteins in same PDB: d1lqgc_, d1lqgd_
    protein/DNA complex

Details for d1lqgb_

PDB Entry: 1lqg (more details), 2.9 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (B:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1lqgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqgb_ c.18.1.1 (B:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp

SCOPe Domain Coordinates for d1lqgb_:

Click to download the PDB-style file with coordinates for d1lqgb_.
(The format of our PDB-style files is described here.)

Timeline for d1lqgb_: