SCOP 1.73: Domain d1lqga_: 1lqg A:

Lineage for d1lqga_ (1lqg A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (4 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1lqga_: 1lqg A: [78131]
   Other proteins in same PDB: d1lqgc_, d1lqgd_

Details for d1lqga_

PDB Entry: 1lqg, 2.9 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

PDB Compounds: (A:) uracil-DNA glycosylase

SCOP Domain Sequences for d1lqga_:

Sequence; same for both SEQRES and ATOM records:

>d1lqga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg
qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll
ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv
lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes

Timeline for d1lqga_:

• d1lqga_ first appeared in SCOP 1.63
  
• d1lqga_ appears in SCOP 1.71
  
• d1lqga_ appears in SCOP 1.75
  
• d1lqga_ appears in the current release, SCOPe 2.08