SCOP 1.75: Domain d1lq9b_: 1lq9 B:

Lineage for d1lq9b_ (1lq9 B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.3: Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82666] (1 protein)

6. Protein Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82667] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [82668] (5 PDB entries)

8. Domain d1lq9b_: 1lq9 B: [78130]
   complexed with pg4

Details for d1lq9b_

PDB Entry: 1lq9, 1.3 Å

PDB Description: Crystal Structure of a Monooxygenase from the Gene ActVA-Orf6 of Streptomyces coelicolor Strain A3(2)

PDB Compounds: (B:) actva-orf6 monooxygenase

SCOP Domain Sequences for d1lq9b_:

Sequence; same for both SEQRES and ATOM records:

>d1lq9b_ d.58.4.3 (B:) Actinorhodin biosynthesis monooxygenase ActVa-Orf6 {Streptomyces coelicolor [TaxId: 1902]}
aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps

Timeline for d1lq9b_:

• d1lq9b_ first appeared in SCOP 1.63
  
• d1lq9b_ appears in SCOP 1.73
  
• d1lq9b_ appears in SCOPe 2.01
  
• d1lq9b_ appears in the current release, SCOPe 2.08